PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_138670_qaws.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 332aa    MW: 37844.7 Da    PI: 4.7787
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_138670_qaws.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.2e-1956109356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Bv6_138670_qaws.t1  56 KKRRLSVDQVKALERNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 109
                         566899***********************************************9 PP

2HD-ZIP_I/II130.37.5e-4255147193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk+++d+lk++ e+L++++e+L +e+
  Bv6_138670_qaws.t1  55 EKKRRLSVDQVKALERNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANFDSLKHNYESLQHDKEALVKEI 145
                         69***************************************************************************************99 PP

         HD-ZIP_I/II  92 ke 93 
                         ke
  Bv6_138670_qaws.t1 146 KE 147
                         87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-1938113IPR009057Homeodomain-like
PROSITE profilePS5007117.29751111IPR001356Homeobox domain
SMARTSM003898.2E-1854115IPR001356Homeobox domain
PfamPF000463.8E-1656109IPR001356Homeobox domain
CDDcd000861.27E-1656112No hitNo description
Gene3DG3DSA:1.10.10.601.3E-1958118IPR009057Homeodomain-like
PRINTSPR000319.6E-68291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000319.6E-691107IPR000047Helix-turn-helix motif
PfamPF021839.2E-18111152IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MKRISSSDSL GALISMCPST DEHSPRNNIY SRDYQSMLDG FDEEGCIEET GHVPEKKRRL  60
SVDQVKALER NFEVENKLEP ERKVKLAQEL GLQPRQVAVW FQNRRARWKT KQLERDYGVL  120
KANFDSLKHN YESLQHDKEA LVKEIKELKS KLNEEQIIES NMCIKEEVLL FESDNNKTTI  180
VEPITPPESL SGGSEEDAKL LKVKNVFTEF KDGPSDSDSS AILNDDNNSS SPNASNSSNG  240
PLFLNQQQQQ QLLMFNNCSS SPSPPSINCF SFSDSRSDGL GSNHNHNNNN NVYHPQFVKI  300
EEHNFFSGEE ACNFFSEEQA PSLHWYCPDQ WS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103111RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681015.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A0J8C9D10.0A0A0J8C9D1_BETVU; Uncharacterized protein
STRINGVIT_07s0191g00180.t011e-132(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.14e-70homeobox protein 16